PDB entry 1dyp

View 1dyp on RCSB PDB site
Description: 1,3-alpha-1,4-beta-d-galactose-4-sulfate-3,6-anhydro-d-galactose 4 galactohydrolase
Class: hydrolase
Keywords: hydrolase, kappa-carrageenan double helix degradation
Deposited on 2000-02-04, released 2001-01-16
The last revision prior to the SCOP 1.73 freeze date was dated 2001-01-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.178
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kappa-carrageenase
    Species: Alteromonas carrageenovora
    Gene: CGKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43478 (0-270)
      • modified residue (1)
      • engineered (51)
      • modified residue (118)
      • modified residue (168)
      • modified residue (224)
      • modified residue (259)
    Domains in SCOP 1.73: d1dypa_
  • Heterogens: CD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dypA (A:)
    smqppiakpgetwilqakrsdefnvkdatkwnfqtenygvwswknenatvskgklklttk
    reshqrtfwdgcnqqqvanyplyytsgvaksratgnygyyearikgastfpgvspafwmy
    stidrsltkegdvqyseidvveltqksavresdhdlhnivvkngkptwmrpgsfpqtnhn
    gyhlpfdprndfhtygvnvtkdkitwyvdgeivgekdnlywhrqmnltlsqglraphtqw
    kcnqfypsanksaegfptsmevdyvrtwvkv