PDB entry 1dyn

View 1dyn on RCSB PDB site
Description: crystal structure at 2.2 angstroms resolution of the pleckstrin homology domain from human dynamin
Class: signal transduction protein
Keywords: signal transduction protein
Deposited on 1994-12-21, released 1995-02-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dynamin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dyna_
  • Chain 'B':
    Compound: dynamin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dynb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dynA (A:)
    mktsgnqdeilvirkgwltinnigimkggskeywfvltaenlswykddeekekkymlsvd
    nlklrdvekgfmsskhifalfnteqrnvykdyrqlelacetqeevdswkasflragvype
    rvgdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dynA (A:)
    ilvirkgwltinnigimkggskeywfvltaenlswykddeekekkymlsvdnlklrdvek
    gfmsskhifalfnteqrnvykdyrqlelacetqeevdswkasflragvyperv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dynB (B:)
    mktsgnqdeilvirkgwltinnigimkggskeywfvltaenlswykddeekekkymlsvd
    nlklrdvekgfmsskhifalfnteqrnvykdyrqlelacetqeevdswkasflragvype
    rvgdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dynB (B:)
    ilvirkgwltinnigimkggskeywfvltaenlswykddeekekkymlsvdnlklrdvek
    gfmsskhifalfnteqrnvykdyrqlelacetqeevdswkasflragvyperv