PDB entry 1dym

View 1dym on RCSB PDB site
Description: Humicola insolens Endocellulase Cel7B (EG 1) E197A Mutant
Class: hydrolase
Keywords: endoglucanase, cellulose degradation, hydrolase, glycosidase, glycoprotein, glycosynthase, glycoside hydrolase family 7
Deposited on 2000-02-03, released 2000-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.158
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase I
    Species: Humicola insolens [TaxId:34413]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56680 (0-End)
      • engineered (196)
    Domains in SCOPe 2.07: d1dyma_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dymA (A:)
    ekpgetkevhpqlttfrctkrggckpatnfivldslshpihraeglgpggcgdwgnpppk
    dvcpdvescakncimegipdysqygvttngtslrlqhilpdgrvpsprvylldktkrrye
    mlhltgfeftfdvdatklpcgmnsalylsemhptgakskynpggayygtgycdaqcfvtp
    finglgniegkgsccnamdiweansrashvaphtcnkkglylcegeecafegvcdkngcg
    wnnyrvnvtdyygrgeefkvntlkpftvvtqflanrrgklekihrfyvqdgkviesfytn
    kegvpytnmiddefceatgsrkymelgatqgmgealtrgmvlamsiwwdqggnmewldhg
    eagpcakgegapsnivqvepfpevtytnlrwgeigstyqelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dymA (A:)
    ekpgetkevhpqlttfrctkrggckpatnfivldslshpihraeglgpggcgdwgnpppk
    dvcpdvescakncimegipdysqygvttngtslrlqhilpdgrvpsprvylldktkrrye
    mlhltgfeftfdvdatklpcgmnsalylsemhptgakskynpggayygtgycdaqcfvtp
    finglgniegkgsccnamdiweansrashvaphtcnkkglylcegeecafegvcdkngcg
    wnnyrvnvtdyygrgeefkvntlkpftvvtqflanrrgklekihrfyvqdgkviesfytn
    kegvpytnmiddefceatgsrkymelgatqgmgealtrgmvlamsiwwdqggnmewldhg
    eagpcakgegapsnivqvepfpevtytnlrwgeigsty