PDB entry 1dyb

View 1dyb on RCSB PDB site
Description: determination of alpha-helix propensity within the context of a folded protein: sites 44 and 131 in bacteriophage t4 lysozyme
Deposited on 1993-05-13, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.75 Å
R-factor: 0.173
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1dyb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dyb_ (-)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
  lqqkrwdeaagnlaksrwynqtpnrakrvittfrtgtwdayk