PDB entry 1dya

View 1dya on RCSB PDB site
Description: determination of alpha-helix propensity within the context of a folded protein: sites 44 and 131 in bacteriophage t4 lysozyme
Deposited on 1993-05-13, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.159
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1dya__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dya_ (-)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
    lqqkrwdeaadnlaksrwynqtpnrakrvittfrtgtwdayk