PDB entry 1dy9

View 1dy9 on RCSB PDB site
Description: inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (inhibitor I)
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, ns3, ns4a, hepatitis c virus, protease inhibition, hydrolase-hydrolase inhibitor complex
Deposited on 2000-01-31, released 2001-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease/helicase ns3 (p70)
    Species: HEPATITIS C VIRUS (ISOLATE 1) [TaxId:31645]
    Gene: HCV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dy9.1
  • Chain 'B':
    Compound: protease/helicase ns3 (p70)
    Species: HEPATITIS C VIRUS (ISOLATE 1) [TaxId:31645]
    Gene: HCV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dy9.2
  • Chain 'C':
    Compound: nonstructural protein ns4a (p4)
    Species: HEPATITIS C VIRUS, synthetic [TaxId:31645]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dy9.1
  • Chain 'D':
    Compound: nonstructural protein ns4a (p4)
    Species: HEPATITIS C VIRUS, synthetic [TaxId:31645]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dy9.2
  • Heterogens: 2ZF, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dy9A (A:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmettmr
    spvftdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dy9A (A:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dy9B (B:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmettmr
    spvftdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dy9B (B:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dy9C (C:)
    kgsvvivgriilsgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dy9C (C:)
    gsvvivgriils
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dy9D (D:)
    kgsvvivgriilsgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dy9D (D:)
    gsvvivgriils