PDB entry 1dy7

View 1dy7 on RCSB PDB site
Description: cytochrome cd1 nitrite reductase, co complex
Deposited on 2000-01-28, released 2000-09-24
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-03, with a file datestamp of 2000-11-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.178
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dy7A (A:)
    ppefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqialidgatyeiksvl
    dtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegw
    edkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefi
    vnvketgkillvdytdldnlktteisaerflhdggldgshryfitaanarnklvvidtke
    gklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkild
    sfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpia
    ewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtp
    tgkfnvyntmtdty
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dy7B (B:)
    laqqdvaapgapegvsalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgf
    dylqsfitygspagmpnwgtsgelsaeqvdlmanyllldpaappefgmkemreswkvhva
    pedrptqqendwdlenlfsvtlrdagqialidgatyeiksvldtgyavhisrlsasgryl
    fvigrdgkvnmidlwmkepttvaeikigsearsietskmegwedkyaiagaywppqyvim
    dgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefivnvketgkillvdytdld
    nlktteisaerflhdggldgshryfitaanarnklvvidtkegklvaiedtggqtphpgr
    ganfvhptfgpvwatshmgddsvaligtdpeghpdnawkildsfpalgggslfikthpns
    qylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaewagitegqprvvqgefn
    kdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtptgkfnvyntmtdty