PDB entry 1dy7

View 1dy7 on RCSB PDB site
Description: cytochrome cd1 nitrite reductase, co complex
Class: oxidoreductase
Keywords: enzyme, nitrite reductase, oxidoreductase
Deposited on 2000-01-28, released 2000-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.178
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dy7a_
  • Chain 'B':
    Compound: nitrite reductase
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dy7b1, d1dy7b2
  • Heterogens: DHE, CMO, GOL, SO4, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dy7A (A:)
    qeqvappkdpaaaledhktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqia
    lidgatyeiksvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdldnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dy7A (A:)
    ppefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqialidgatyeiksvl
    dtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigsearsietskmegw
    edkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefi
    vnvketgkillvdytdldnlktteisaerflhdggldgshryfitaanarnklvvidtke
    gklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtdpeghpdnawkild
    sfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpia
    ewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtp
    tgkfnvyntmtdty
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dy7B (B:)
    qeqvappkdpaaaledhktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneanki
    yfercagchgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqv
    dlmanyllldpaappefgmkemreswkvhvapedrptqqendwdlenlfsvtlrdagqia
    lidgatyeiksvldtgyavhisrlsasgrylfvigrdgkvnmidlwmkepttvaeikigs
    earsietskmegwedkyaiagaywppqyvimdgetlepkkiqstrgmtydeqeyhpeprv
    aailashyrpefivnvketgkillvdytdldnlktteisaerflhdggldgshryfitaa
    narnklvvidtkegklvaiedtggqtphpgrganfvhptfgpvwatshmgddsvaligtd
    peghpdnawkildsfpalgggslfikthpnsqylyvdatlnpeaeisgsvavfdikamtg
    dgsdpefktlpiaewagitegqprvvqgefnkdgtevwfsvwngkdqesalvvvddktle
    lkhvikderlvtptgkfnvyntmtdty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dy7B (B:)
    laqqdvaapgapegvsalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgf
    dylqsfitygspagmpnwgtsgelsaeqvdlmanyllldpaappefgmkemreswkvhva
    pedrptqqendwdlenlfsvtlrdagqialidgatyeiksvldtgyavhisrlsasgryl
    fvigrdgkvnmidlwmkepttvaeikigsearsietskmegwedkyaiagaywppqyvim
    dgetlepkkiqstrgmtydeqeyhpeprvaailashyrpefivnvketgkillvdytdld
    nlktteisaerflhdggldgshryfitaanarnklvvidtkegklvaiedtggqtphpgr
    ganfvhptfgpvwatshmgddsvaligtdpeghpdnawkildsfpalgggslfikthpns
    qylyvdatlnpeaeisgsvavfdikamtgdgsdpefktlpiaewagitegqprvvqgefn
    kdgtevwfsvwngkdqesalvvvddktlelkhvikderlvtptgkfnvyntmtdty