PDB entry 1dy6

View 1dy6 on RCSB PDB site
Description: Structure of the imipenem-hydrolyzing beta-lactamase SME-1
Class: hydrolase
Keywords: hydrolase, lactamase, antibiotic, carbapenem, imipenem
Deposited on 2000-01-27, released 2001-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbapenem-hydrolysing beta-lactamase sme-1
    Species: SERRATIA MARCESCENS [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dy6a_
  • Chain 'B':
    Compound: carbapenem-hydrolysing beta-lactamase sme-1
    Species: SERRATIA MARCESCENS [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dy6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dy6A (A:)
    nksdaaakqikkleedfdgrigvfaidtgsgntfgyrsderfplcssfkgflaaavlerv
    qqkkldinqkvkyesrdleyhspittkykgsgmtlgdmasaalqysdngatniimerflg
    gpegmtkfmrsigdnefrldrwelelntaipgdkrdtstpkavanslnklalgnvlnakv
    kaiyqnwlkgnttgdarirasvpadwvvgdktgscgaygtandyaviwpknraplivsiy
    ttrkskddkhsdktiaeasriaiqaid
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dy6B (B:)
    nksdaaakqikkleedfdgrigvfaidtgsgntfgyrsderfplcssfkgflaaavlerv
    qqkkldinqkvkyesrdleyhspittkykgsgmtlgdmasaalqysdngatniimerflg
    gpegmtkfmrsigdnefrldrwelelntaipgdkrdtstpkavanslnklalgnvlnakv
    kaiyqnwlkgnttgdarirasvpadwvvgdktgscgaygtandyaviwpknraplivsiy
    ttrkskddkhsdktiaeasriaiqaid