PDB entry 1dy5

View 1dy5 on RCSB PDB site
Description: Deamidated derivative of bovine pancreatic ribonuclease
Class: hydrolase
Keywords: hydrolase, ribonuclease, deamidation
Deposited on 2000-01-27, released 2000-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 0.8700000000000001 Å
R-factor: N/A
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-123)
      • conflict (66)
    Domains in SCOPe 2.08: d1dy5a_
  • Chain 'B':
    Compound: ribonuclease a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61823 (0-123)
      • conflict (66)
    Domains in SCOPe 2.08: d1dy5b_
  • Heterogens: SO4, ACT, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dy5A (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackdgqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dy5B (B:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackdgqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv