PDB entry 1dy3

View 1dy3 on RCSB PDB site
Description: ternary complex of 7,8-dihydro-6-hydroxymethylpterinpyrophosphokinase from escherichia coli with atp and a substrate analogue.
Deposited on 2000-01-21, released 2000-08-18
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dy3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dy3A (A:)
    tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
    etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
    rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw