PDB entry 1dy3

View 1dy3 on RCSB PDB site
Description: ternary complex of 7,8-dihydro-6-hydroxymethylpterinpyrophosphokinase from escherichia coli with ATP and a substrate analogue.
Class: pyrophosphorylase
Keywords: pyrophosphorylase, de novo folate biosynthesis
Deposited on 2000-01-21, released 2000-08-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26281 (0-157)
  Domains in SCOPe 2.08: d1dy3a_
• Heterogens: ATP, 87Y, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dy3A (A:)
  tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
  etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
  rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw