PDB entry 1dy1

View 1dy1 on RCSB PDB site
Description: Murine endostatin, crystal form III
Class: angiogenesis inhibitor
Keywords: angiogenesis inhibitor
Deposited on 2000-01-21, released 2001-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: collagen alpha1(xviii) chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39061 (0-End)
      • engineered mutation (0-1)
    Domains in SCOPe 2.07: d1dy1a_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dy1A (A:)
    aplahthqdfqpvlhlvalntplsggmrgirgadfqcfqqaravglsgtfraflssrlqd
    lysivrradrgsvpivnlkdevlspswdslfsgsqgqlqpgarifsfdgrdvlrhpawpq
    ksvwhgsdpsgrrlmesycetwrtettgatgqassllsgrlleqkaaschnsyivlcien
    sfmtsfsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dy1A (A:)
    aplahthqdfqpvlhlvalntplsggmrgirgadfqcfqqaravglsgtfraflssrlqd
    lysivrradrgsvpivnlkdevlspswdslfsgsqgqlqpgarifsfdgrdvlrhpawpq
    ksvwhgsdpsgrrlmesycetwrtettgatgqassllsgrlleqkaaschnsyivlcien
    sfm