PDB entry 1dxz

View 1dxz on RCSB PDB site
Description: m2 transmembrane segment of alpha-subunit of nicotinic acetylcholine receptor from torpedo californica, nmr, 20 structures
Class: transmembrane protein
Keywords: transmembrane protein, nicotinic acetylcholine receptor, transmembrane segment, m2, ion-channel
Deposited on 2000-01-20, released 2000-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: acetylcholine receptor protein, alpha chain
  Species: TORPEDO CALIFORNICA, synthetic [TaxId:7787]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02710 (0-31)
  Domains in SCOPe 2.08: d1dxza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dxzA (A:)
  ptdsgekmtlsisvllsltvfllvivelipst