PDB entry 1dxx

View 1dxx on RCSB PDB site
Description: n-terminal actin-binding domain of human dystrophin
Deposited on 2000-01-20, released 2000-05-16
The last revision prior to the SCOP 1.71 freeze date was dated 2000-05-16, with a file datestamp of 2000-05-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.232
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dxxA (A:)
    mlwweevedsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgq
    klpkekgstrvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqv
    knvmknimaglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdl
    fdwnsvvsqqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlp
    qqvsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxxA (A:)
    dsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgqklpkekgs
    trvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqvknvmknim
    aglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdlfdwnsvvs
    qqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlpqqvsie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dxxB (B:)
    mlwweevedsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgq
    klpkekgstrvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqv
    knvmknimaglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdl
    fdwnsvvsqqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlp
    qqvsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxxB (B:)
    dsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgqklpkekgs
    trvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqvknvmknim
    aglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdlfdwnsvvs
    qqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlpqqvsie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dxxC (C:)
    mlwweevedsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgq
    klpkekgstrvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqv
    knvmknimaglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdl
    fdwnsvvsqqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlp
    qqvsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxxC (C:)
    dsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgqklpkekgs
    trvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqvknvmknim
    aglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdlfdwnsvvs
    qqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlpqqvsie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dxxD (D:)
    mlwweevedsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgq
    klpkekgstrvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqv
    knvmknimaglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdl
    fdwnsvvsqqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlp
    qqvsie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxxD (D:)
    dsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgqklpkekgs
    trvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwqvknvmknim
    aglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdlfdwnsvvs
    qqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvlpqqvsie