PDB entry 1dxw

View 1dxw on RCSB PDB site
Description: structure of hetero complex of non structural protein (NS) of hepatitis C virus (HCV) and synthetic peptidic compound
Class: hydrolase/hydrolase inhibitor
Keywords: non structural protein, hepatitis c virus, serine protease, hydrolase-hydrolase inhibitor complex
Deposited on 2000-01-17, released 2001-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease
    Species: HEPATITIS C VIRUS [TaxId:11103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P90191 (Start-179)
      • see remark 999 (180-185)
    Domains in SCOPe 2.08: d1dxwa1, d1dxwa2
  • Heterogens: 2ZF, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dxwA (A:)
    apitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmr
    askkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxwA (A:)
    tgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsktlagpkgpitqmytnvdqd
    lvgwqappgarsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpvsylkgssgg
    pllcpsghavgifraavctrgvakavdfvpvesmettmraskkkk