PDB entry 1dxs

View 1dxs on RCSB PDB site
Description: crystal structure of the c-terminal sterile alpha motif (sam) domain of human p73 alpha splice variant
Class: gene regulation
Keywords: p73 sam-like domain, gene regulation, p53 p63 homologue, sterile alpha motif, tumour supressor
Deposited on 2000-01-15, released 2001-01-12
The last revision prior to the SCOP 1.73 freeze date was dated 2001-01-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.275
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p53-like transcription factor
    Species: HOMO SAPIENS
    Gene: P73
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1dxsa_
  • Heterogens: OH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dxsA (A:)
    gsyhadpslvsfltglgcpncieyftsqglqsiyhlqnltiedlgalkipeqyrmtiwrg
    lqdlkqghdystaqqllrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxsA (A:)
    slvsfltglgcpncieyftsqglqsiyhlqnltiedlgalkipeqyrmtiwrglqdl