PDB entry 1dxs

View 1dxs on RCSB PDB site
Description: crystal structure of the c-terminal sterile alpha motif (sam) domain of human p73 alpha splice variant
Deposited on 2000-01-15, released 2001-01-12
The last revision prior to the SCOP 1.69 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.275
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1dxsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dxsA (A:)
    gsyhadpslvsfltglgcpncieyftsqglqsiyhlqnltiedlgalkipeqyrmtiwrg
    lqdlkqghdystaqqllrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxsA (A:)
    slvsfltglgcpncieyftsqglqsiyhlqnltiedlgalkipeqyrmtiwrglqdl