PDB entry 1dxs

View 1dxs on RCSB PDB site
Description: crystal structure of the c-terminal sterile alpha motif (sam) domain of human p73 alpha splice variant
Deposited on 2000-01-15, released 2001-01-12
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-12, with a file datestamp of .
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.275
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dxsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxsA (A:)
    slvsfltglgcpncieyftsqglqsiyhlqnltiedlgalkipeqyrmtiwrglqdl