PDB entry 1dxq

View 1dxq on RCSB PDB site
Description: crystal structure of mouse nad[p]h-quinone oxidoreductase
Deposited on 2000-01-14, released 2000-04-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-17, with a file datestamp of 2000-04-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.207
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dxqa_
  • Chain 'B':
    Domains in SCOP 1.55: d1dxqb_
  • Chain 'C':
    Domains in SCOP 1.55: d1dxqc_
  • Chain 'D':
    Domains in SCOP 1.55: d1dxqd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxqA (A:)
    aarralivlahsektsfnyamkeaavealkkrgwevlesdlyamnfnpiisrnditgelk
    dsknfqypsesslaykegrlspdivaehkkleaadlvifqfplqwfgvpailkgwfervl
    vagfaytyaamydngpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
    fqvlepqlvysightppdarmqilegwkkrletvweetplyfapsslfdlnfqagfllmk
    evqeeqkknkfglsvghhlgksipadnqikark
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxqB (B:)
    aarralivlahsektsfnyamkeaavealkkrgwevlesdlyamnfnpiisrnditgelk
    dsknfqypsesslaykegrlspdivaehkkleaadlvifqfplqwfgvpailkgwfervl
    vagfaytyaamydngpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
    fqvlepqlvysightppdarmqilegwkkrletvweetplyfapsslfdlnfqagfllmk
    evqeeqkknkfglsvghhlgksipadnqikark
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxqC (C:)
    aarralivlahsektsfnyamkeaavealkkrgwevlesdlyamnfnpiisrnditgelk
    dsknfqypsesslaykegrlspdivaehkkleaadlvifqfplqwfgvpailkgwfervl
    vagfaytyaamydngpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
    fqvlepqlvysightppdarmqilegwkkrletvweetplyfapsslfdlnfqagfllmk
    evqeeqkknkfglsvghhlgksipadnqikark
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxqD (D:)
    aarralivlahsektsfnyamkeaavealkkrgwevlesdlyamnfnpiisrnditgelk
    dsknfqypsesslaykegrlspdivaehkkleaadlvifqfplqwfgvpailkgwfervl
    vagfaytyaamydngpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
    fqvlepqlvysightppdarmqilegwkkrletvweetplyfapsslfdlnfqagfllmk
    evqeeqkknkfglsvghhlgksipadnqikark