PDB entry 1dxp

View 1dxp on RCSB PDB site
Description: Inhibition of the Hepatitis C Virus NS3/4A Protease. The Crystal Structures of Two Protease-Inhibitor Complexes (apo structure)
Class: hydrolase
Keywords: serine protease, ns3, ns4a, hepatitis c virus, protease inhibition, hydrolase
Deposited on 2000-01-13, released 2001-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease/helicase ns3 (p70)
    Species: HEPATITIS C VIRUS (ISOLATE TAIWAN) [TaxId:31645]
    Gene: HCV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dxp.1
  • Chain 'B':
    Compound: protease/helicase ns3 (p70)
    Species: HEPATITIS C VIRUS (ISOLATE TAIWAN) [TaxId:31645]
    Gene: HCV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dxp.2
  • Chain 'C':
    Compound: nonstructural protein ns4a (p4)
    Species: HEPATITIS C VIRUS, synthetic [TaxId:31645]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dxp.1
  • Chain 'D':
    Compound: nonstructural protein ns4a (p4)
    Species: HEPATITIS C VIRUS, synthetic [TaxId:31645]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dxp.2
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dxpA (A:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmettmr
    spvftdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxpA (A:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dxpB (B:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmettmr
    spvftdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxpB (B:)
    apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
    sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
    dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dxpC (C:)
    kgsvvivgriilsgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxpC (C:)
    gsvvivgriils
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dxpD (D:)
    kgsvvivgriilsgrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxpD (D:)
    gsvvivgriils