PDB entry 1dxm

View 1dxm on RCSB PDB site
Description: reduced form of the h protein from glycine decarboxylase complex
Class: oxidoreductases(acting on ch-nh2 donor)
Keywords: oxidoreductases(acting on ch-nh2 donor), glycine decarboxylase, mitochondria,
Deposited on 2000-01-10, released 2000-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.204
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h protein
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dxma_
  • Chain 'B':
    Compound: h protein
    Species: PISUM SATIVUM [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dxmb_
  • Heterogens: RED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dxmA (A:)
snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave
svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey
tkfceeedaah

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dxmB (B:)
snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave
svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey
tkfceeedaah