PDB entry 1dxl

View 1dxl on RCSB PDB site
Description: Dihydrolipoamide dehydrogenase of glycine decarboxylase from Pisum Sativum
Deposited on 2000-01-10, released 2000-07-04
The last revision prior to the SCOP 1.57 freeze date was dated 2000-07-04, with a file datestamp of 2000-07-04.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.226
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxlA (A:)
    sdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhsshmy
    heakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkfvsp
    seisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkklvvi
    gagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktkvvg
    vdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgrilvne
    rfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpevas
    vgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimapnag
    eliheaaialqydassediarvchahptmseaikeaamatydkpihi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxlB (B:)
    sdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhsshmy
    heakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkfvsp
    seisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkklvvi
    gagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktkvvg
    vdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgrilvne
    rfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpevas
    vgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimapnag
    eliheaaialqydassediarvchahptmseaikeaamatydkpihi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxlC (C:)
    sdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhsshmy
    heakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkfvsp
    seisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkklvvi
    gagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktkvvg
    vdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgrilvne
    rfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpevas
    vgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimapnag
    eliheaaialqydassediarvchahptmseaikeaamatydkpihi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxlD (D:)
    sdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhsshmy
    heakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkfvsp
    seisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkklvvi
    gagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktkvvg
    vdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgrilvne
    rfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpevas
    vgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimapnag
    eliheaaialqydassediarvchahptmseaikeaamatydkpihi