PDB entry 1dxl

View 1dxl on RCSB PDB site
Description: Dihydrolipoamide dehydrogenase of glycine decarboxylase from Pisum Sativum
Class: oxidoreductase
Keywords: oxidoreductase, dihydrolipoamide dehydrogenase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex, flavoprotein
Deposited on 2000-01-10, released 2000-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.226
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrolipoamide dehydrogenase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31023 (Start-469)
      • conflict (448)
    Domains in SCOPe 2.07: d1dxla1, d1dxla2, d1dxla3
  • Chain 'B':
    Compound: dihydrolipoamide dehydrogenase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31023 (Start-469)
      • conflict (448)
    Domains in SCOPe 2.07: d1dxlb1, d1dxlb2, d1dxlb3
  • Chain 'C':
    Compound: dihydrolipoamide dehydrogenase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31023 (Start-469)
      • conflict (448)
    Domains in SCOPe 2.07: d1dxlc1, d1dxlc2, d1dxlc3
  • Chain 'D':
    Compound: dihydrolipoamide dehydrogenase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31023 (Start-469)
      • conflict (448)
    Domains in SCOPe 2.07: d1dxld1, d1dxld2, d1dxld3
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dxlA (A:)
    asgsdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhss
    hmyheakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkf
    vspseisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkkl
    vvigagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktk
    vvgvdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgril
    vnerfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpe
    vasvgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimap
    nageliheaaialqydassediarvchahptmseaikeaamatydkpihi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxlA (A:)
    sdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhsshmy
    heakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkfvsp
    seisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkklvvi
    gagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktkvvg
    vdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgrilvne
    rfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpevas
    vgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimapnag
    eliheaaialqydassediarvchahptmseaikeaamatydkpihi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dxlB (B:)
    asgsdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhss
    hmyheakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkf
    vspseisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkkl
    vvigagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktk
    vvgvdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgril
    vnerfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpe
    vasvgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimap
    nageliheaaialqydassediarvchahptmseaikeaamatydkpihi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxlB (B:)
    sdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhsshmy
    heakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkfvsp
    seisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkklvvi
    gagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktkvvg
    vdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgrilvne
    rfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpevas
    vgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimapnag
    eliheaaialqydassediarvchahptmseaikeaamatydkpihi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dxlC (C:)
    asgsdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhss
    hmyheakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkf
    vspseisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkkl
    vvigagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktk
    vvgvdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgril
    vnerfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpe
    vasvgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimap
    nageliheaaialqydassediarvchahptmseaikeaamatydkpihi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxlC (C:)
    sdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhsshmy
    heakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkfvsp
    seisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkklvvi
    gagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktkvvg
    vdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgrilvne
    rfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpevas
    vgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimapnag
    eliheaaialqydassediarvchahptmseaikeaamatydkpihi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dxlD (D:)
    asgsdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhss
    hmyheakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkf
    vspseisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkkl
    vvigagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktk
    vvgvdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgril
    vnerfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpe
    vasvgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimap
    nageliheaaialqydassediarvchahptmseaikeaamatydkpihi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxlD (D:)
    sdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhsshmy
    heakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkfvsp
    seisvdtiegentvvkgkhiiiatgsdvkslpgvtidekkivsstgalalseipkklvvi
    gagyiglemgsvwgrigsevtvvefaseivptmdaeirkqfqrslekqgmkfklktkvvg
    vdtsgdgvkltvepsaggeqtiieadvvlvsagrtpftsglnldkigvetdklgrilvne
    rfstnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvdydkvpgvvytnpevas
    vgkteeqvketgveyrvgkfpfmansrakaidnaeglvkiiaeketdkilgvhimapnag
    eliheaaialqydassediarvchahptmseaikeaamatydkpihi