PDB entry 1dxk

View 1dxk on RCSB PDB site
Description: Metallo-beta-lactamase from Bacillus cereus 569/H/9 C168S mutant
Class: hydrolase
Keywords: hydrolase, hydrolase (beta-lactamase), metallo beta-lactamase
Deposited on 2000-01-10, released 2000-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.2054
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class b beta-lactamase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04190 (Start-226)
      • engineered (167)
    Domains in SCOPe 2.07: d1dxka_
  • Heterogens: ZN, BCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dxkA (A:)
    sqkvektviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswd
    dkltkeliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngy
    eeplgdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggslvkstsakdlgn
    vadayvnewstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dxkA (A:)
    tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
    liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
    lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggslvkstsakdlgnvadayv
    newstsienvlkryrninavvpghgevgdkglllhtldllk