PDB entry 1dxj

View 1dxj on RCSB PDB site
Description: Structure of the chitinase from jack bean
Class: hydrolase
Keywords: hydrolase, family 19 glycosidase, alpha helical protein
Deposited on 2000-01-10, released 2000-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class II chitinase
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dxja_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxjA (A:)
    dvgsvidaslfdqllkhrndpacegkgfysynafvtaarsfggfgttgdtntrkrevaaf
    laqtshettggaagspdgpyawgycfvterdksnkycdpgtpcpagksyygrgpiqlthn
    ynyaqagralgvdlinnpdlvardavisfktaiwfwmtpqgnkpschdvitnrwtpsaad
    vaanrtpgfgvitniinggiecgrgpspasgdrigfykrycdvlhlsygpnlncrdqrpf
    gg