PDB entry 1dxh

View 1dxh on RCSB PDB site
Description: Catabolic ornithine carbamoyltransferase from Pseudomonas aeruginosa
Class: transferase
Keywords: transferase, transcarbamylase
Deposited on 2000-01-05, released 2001-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ornithine carbamoyltransferase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dxha1, d1dxha2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxhA (A:)
    afnmhnrnllslmhhstrelrylldlsrdlkrakytgteqqhlkrknialifektstrtr
    cafevaaydqganvtyidpnssqighkesmkdtarvlgrmydaieyrgfkqeiveelakf
    agvpvfngltdeyhptqmladvltmrehsdkplhdisyaylgdarnnmgnsllligaklg
    mdvriaapkalwphdefvaqckkfaeesgakltltedpkeavkgvdfvhtdvwvsmgepv
    eawgerikellpyqvnmeimkatgnprakfmhclpafhnsetkvgkqiaeqypnlangie
    vtedvfespyniafeqaenrmhtikailvstladi