PDB entry 1dxg

View 1dxg on RCSB PDB site
Description: crystal structure of desulforedoxin from desulfovibrio gigas at 1.8 a resolution
Deposited on 1997-07-04, released 1997-11-12
The last revision prior to the SCOP 1.59 freeze date was dated 1997-11-12, with a file datestamp of 1997-11-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1dxga_
  • Chain 'B':
    Domains in SCOP 1.59: d1dxgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxgA (A:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxgB (B:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq