PDB entry 1dxg

View 1dxg on RCSB PDB site
Description: crystal structure of desulforedoxin from desulfovibrio gigas at 1.8 a resolution
Class: non-heme iron protein
Keywords: non-heme iron protein, rubredoxin type metal center, electron transport
Deposited on 1997-07-04, released 1997-11-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: desulforedoxin
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dxga_
  • Chain 'B':
    Compound: desulforedoxin
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dxgb_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxgA (A:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxgB (B:)
    anegdvykcelcgqvvkvleegggtlvccgedmvkq