PDB entry 1dxc

View 1dxc on RCSB PDB site
Description: CO complex of Myoglobin Mb-YQR at 100K
Class: oxygen storage
Keywords: oxygen storage, co complex, respiratory protein
Deposited on 2000-01-03, released 2000-04-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon, synthetic [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered mutation (29)
      • engineered mutation (64)
      • engineered mutation (67)
      • engineered mutation (122)
    Domains in SCOPe 2.08: d1dxca_
  • Heterogens: HEM, CMO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dxcA (A:)
    mvlsegewqlvlhvwakveadvaghgqdiyirlfkshpetlekfdrfkhlkteaemkase
    dlkkqgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg