PDB entry 1dx9

View 1dx9 on RCSB PDB site
Description: w57a apoflavodoxin from anabaena
Class: flavoprotein
Keywords: flavoprotein
Deposited on 1999-12-23, released 2000-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.169
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11241 (Start-168)
      • engineered (56)
    Domains in SCOPe 2.06: d1dx9a_
  • Chain 'B':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11241 (Start-168)
      • engineered (56)
    Domains in SCOPe 2.06: d1dx9b_
  • Chain 'C':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11241 (Start-168)
      • engineered (56)
    Domains in SCOPe 2.06: d1dx9c_
  • Chain 'D':
    Compound: flavodoxin
    Species: Anabaena sp. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11241 (Start-168)
      • engineered (56)
    Domains in SCOPe 2.06: d1dx9d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dx9A (A:)
    skkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanig
    elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dx9A (A:)
    kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanige
    lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
    tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dx9B (B:)
    skkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanig
    elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dx9B (B:)
    kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanige
    lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
    tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dx9C (C:)
    skkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanig
    elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dx9C (C:)
    kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanige
    lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
    tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dx9D (D:)
    skkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanig
    elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
    stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dx9D (D:)
    kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanige
    lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
    tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl