PDB entry 1dx1

View 1dx1 on RCSB PDB site
Description: bovine prion protein residues 23-230
Class: protein fibril
Keywords: protein fibril, prion protein, repeat structure
Deposited on 1999-12-15, released 2000-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prion protein
    Species: Bos taurus [TaxId:9913]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dx1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dx1A (A:)
    gskkrpkpgggwntggsrypgqgspggnryppqggggwgqphgggwgqphgggwgqphgg
    gwgqphgggwgqphggggwgqggthgqwnkpskpktnmkhvagaaaagavvgglggymlg
    samsrplihfgsdyedryyrenmhrypnqvyyrpvdqysnqnnfvhdcvnitvkehtvtt
    ttkgenftetdikmmervveqmcitqyqresqayyqrga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dx1A (A:)
    glggymlgsamsrplihfgsdyedryyrenmhrypnqvyyrpvdqysnqnnfvhdcvnit
    vkehtvttttkgenftetdikmmervveqmcitqyqresqayyq