PDB entry 1dwy

View 1dwy on RCSB PDB site
Description: bovine prion protein fragment 121-230
Class: prion protein
Keywords: prion protein, prion, brain, repeat
Deposited on 1999-12-15, released 2000-07-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prion protein
    Species: Bos taurus [TaxId:9913]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dwya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1dwyA (A:)
gsvvgglggymlgsamsrplihfgsdyedryyrenmhrypnqvyyrpvdqysnqnnfvhd
cvnitvkehtvttttkgenftetdikmmervveqmcitqyqresqayyqrga

    Sequence, based on observed residues (ATOM records): (download) 
    >1dwyA (A:)
glggymlgsamsrplihfgsdyedryyrenmhrypnqvyyrpvdqysnqnnfvhdcvnit
vkehtvttttkgenftetdikmmervveqmcitqyqresqayyq