PDB entry 1dwx

View 1dwx on RCSB PDB site
Description: murine inducible nitric oxide synthase oxygenase dimer n-hydroxyarginine and tetrahydrobiopterin
Class: oxidoreductase/transferase
Keywords: oxidoreductase transferase complex, complex (oxidoreductase/transferase), nitric oxide monooxygenase, heme, dimer, intermediate, pterin, h4b, tetrahydrobiopterin
Deposited on 1999-12-14, released 2000-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.238
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitric oxide synthase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dwxa_
  • Chain 'B':
    Compound: nitric oxide synthase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dwxb_
  • Heterogens: HEM, H4B, SO4, HAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dwxA (A:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dwxA (A:)
    qyvriknwgsgeilhdtlhhkatsdsclgsimnpksltrgprdkptpleellphaiefin
    qyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsn
    lqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqlirya
    gyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvle
    vtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqr
    ynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmq
    neyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dwxB (B:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dwxB (B:)
    qyvriknwgsgeilhdtlhhkatclgsimnpksltrgprdkptpleellphaiefinqyy
    gsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlqv
    fdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagyq
    mpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevtm
    ehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqryni
    leevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqney
    rarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq