PDB entry 1dwv

View 1dwv on RCSB PDB site
Description: murine inducible nitric oxide synthase oxygenase dimer n-hydroxyarginine and 4-amino tetrahydrobiopterin
Class: oxidoreductase/transferase
Keywords: oxidoreductase transferase complex, complex (oxidoreductase/transferase), nitric oxide monooxygenase, heme, dimer, intermediate, pterin, 4-amino-tetrahydrobiopterin
Deposited on 1999-12-14, released 2000-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.247
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitric oxide synthase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dwva_
  • Chain 'B':
    Compound: nitric oxide synthase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dwvb_
  • Heterogens: HEM, 4AB, ZN, SO4, HAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwvA (A:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwvB (B:)
    qyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprdkptpleellph
    aiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcig
    riqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwns
    qliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeip
    pdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrd
    fcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtases
    fmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthiwq