PDB entry 1dwu

View 1dwu on RCSB PDB site
Description: Ribosomal protein L1
Class: ribosomal protein
Keywords: ribosomal protein, RNA binding, protein synthesis
Deposited on 1999-12-13, released 2000-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein l1
    Species: METHANOCOCCUS THERMOLITHOTROPHICUS [TaxId:2186]
    Gene: THE CORRESPONDING GENE IN E. COLI IS RPLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dwua_
  • Chain 'B':
    Compound: ribosomal protein l1
    Species: METHANOCOCCUS THERMOLITHOTROPHICUS [TaxId:2186]
    Gene: THE CORRESPONDING GENE IN E. COLI IS RPLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dwub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwuA (A:)
    mdrenilkavkearslakprnftqsldliinlkeldlsrpenrlkeqvvlpngrgkepki
    aviakgdlaaqaeemgltvirqdeleelgknkkmakkianehdffiaqadmmplvgktlg
    pvlgprgkmpqpvpananltplverlkktvlintrdkplfhvlvgnekmsdeelaeniea
    ilntvsrkyekglyhvksaytkltmgppaqiek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwuB (B:)
    mdrenilkavkearslakprnftqsldliinlkeldlsrpenrlkeqvvlpngrgkepki
    aviakgdlaaqaeemgltvirqdeleelgknkkmakkianehdffiaqadmmplvgktlg
    pvlgprgkmpqpvpananltplverlkktvlintrdkplfhvlvgnekmsdeelaeniea
    ilntvsrkyekglyhvksaytkltmgppaqiek