PDB entry 1dwt

View 1dwt on RCSB PDB site
Description: photorelaxed horse heart myoglobin co complex
Deposited on 1999-12-12, released 2000-03-03
The last revision prior to the SCOP 1.57 freeze date was dated 2000-03-03, with a file datestamp of 2000-03-03.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.197
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1dwta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dwtA (A:)
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfq