PDB entry 1dwr

View 1dwr on RCSB PDB site
Description: myoglobin (horse heart) wild-type complexed with co
Deposited on 1999-12-11, released 2000-03-03
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-03, with a file datestamp of 2000-03-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.211
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dwra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwrA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfq