PDB entry 1dwp

View 1dwp on RCSB PDB site
Description: crystal structure of hydroxynitrile lyase from manihot esculenta at 2.2 angstrom resolution
Class: hydroxynitrile lyase
Keywords: hydroxynitrile lyase, cyanogenesis
Deposited on 1999-12-10, released 2000-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxynitrile lyase
    Species: MANIHOT ESCULENTA [TaxId:3983]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DWP (0-4)
      • cloning artifact (0-4)
    • Uniprot P52705 (5-261)
    Domains in SCOPe 2.06: d1dwpa1, d1dwpa2
  • Chain 'B':
    Compound: hydroxynitrile lyase
    Species: MANIHOT ESCULENTA [TaxId:3983]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DWP (Start-4)
      • cloning artifact (4)
    • Uniprot P52705 (5-261)
    Domains in SCOPe 2.06: d1dwpb1, d1dwpb2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwpA (A:)
    piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
    yseplltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsy
    tvekllesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
    gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
    klqltkteevahilqevadaya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dwpB (B:)
    piskmvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfde
    yseplltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsy
    tvekllesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrk
    gslfqnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdh
    klqltkteevahilqevadaya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dwpB (B:)
    mvtahfvlihtichgawiwhklkpaleraghkvtaldmaasgidprqieqinsfdeysep
    lltfleklpqgekviivgescaglniaiaadryvdkiaagvfhnsllpdtvhspsytvek
    llesfpdwrdteyftftnitgetittmklgfvllrenlftkctdgeyelakmvmrkgslf
    qnvlaqrpkftekgygsikkvyiwtdqdkiflpdfqrwqianykpdkvyqvqggdhklql
    tkteevahilqevadaya