PDB entry 1dwn

View 1dwn on RCSB PDB site
Description: Strucure of bacteriophage PP7 from Pseudomonas aeruginosa at 3.7 A resolution
Deposited on 1999-12-09, released 2000-02-07
The last revision prior to the SCOP 1.57 freeze date was dated 2000-03-31, with a file datestamp of 2000-03-31.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.288
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1dwna_
  • Chain 'B':
    Domains in SCOP 1.57: d1dwnb_
  • Chain 'C':
    Domains in SCOP 1.57: d1dwnc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwnA (A:)
    sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
    qadvvdcstsvcgelpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvv
    nlvplgr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwnB (B:)
    sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
    qadvvdcstsvcgelpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvv
    nlvplgr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwnC (C:)
    sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
    qadvvdcstsvcgelpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvv
    nlvplgr