PDB entry 1dwm

View 1dwm on RCSB PDB site
Description: solution structure of linum usitatissinum trypsin inhibitor (luti)
Class: serine proteinase inhibitor
Keywords: serine proteinase inhibitor, trypsin inhibitor
Deposited on 1999-12-08, released 1999-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: linum usitatissinum trypsin inhibitor
    Species: LINUM USITATISSIMUM [TaxId:4006]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DWM (Start-68)
    Domains in SCOPe 2.07: d1dwma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwmA (A:)
    srrcpgknawpelvgksgnmaaatverenrnvhaivlkegsamtkdfrcdrvwvivndhg
    vvtsvphit