PDB entry 1dwj

View 1dwj on RCSB PDB site
Description: study on radiation damage on a cryocooled crystal. Refined part 6: structure after a radiation dose of 54*10e15 photons/mm2
Class: hydrolase
Keywords: glycosidase, radiation damage, radiolysis, cryo-cooled, hydrolase
Deposited on 1999-12-05, released 2000-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: myrosinase ma1
    Species: SINAPIS ALBA [TaxId:3728]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29736 (0-498)
      • see remark 999 (494)
    Domains in SCOPe 2.08: d1dwjm_
  • Heterogens: NAG, ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dwjM (M:)
    eitcqenlpftcgntdalnsssfssdfifgvassayqiegtigrglniwdgfthrypnks
    gpdhgngdttcdsfsywqkdidvldelnatgyrfsiawsriiprgkrsrgvnekgidyyh
    glisglikkgitpfvtlfhwdlpqtlqdeyegfldpqiiddfkdyadlcfeefgdsvkyw
    ltinqlysvptrgygsaldapgrcsptvdpscyagnsstepyivahhqllahakvvdlyr
    knythqggkigptmitrwflpyndtdrhsiaatermkefflgwfmgpltngtypqimidt
    vgerlpsfspeesnlvkgsydflglnyyftqyaqpspnpvnstnhtammdagakltyina
    sghyigplfekdkadstdniyyypkgiysvmdyfknkyynpliyvtengistpgdenrnq
    smldytridylcshlcflnkvikekdvnvkgylawalgdnyefnkgftvrfglsyidwnn
    vtdrdlkksgqwyqtfisp