PDB entry 1dw7

View 1dw7 on RCSB PDB site
Description: solution structure of a 8.3 kda protein (gene mth1184) from methanobacterium thermoautotrophicum
Class: structural genomics, unknown function
Keywords: beta+alpha complex structure
Deposited on 2000-01-24, released 2000-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2000-12-11, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 8.3 kda protein (gene mth1184)
  Species: Methanobacterium thermoautotrophicum
  Gene: MTH1184
  Database cross-references and differences (RAF-indexed):
  • GB AE000887 (0-70)
  Domains in SCOPe 2.08: d1dw7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dw7A (A:)
  myiifrcdcgralysregaktrkcvcgrtvnvkdrrifgraddfeeaselvrklqeekyg
  schftnpskre