PDB entry 1dw3

View 1dw3 on RCSB PDB site
Description: structure of a reduced oxygen binding cytochrome c
Deposited on 2000-01-24, released 2000-06-22
The last revision prior to the SCOP 1.57 freeze date was dated 2000-12-27, with a file datestamp of 2000-12-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1dw3a_
  • Chain 'B':
    Domains in SCOP 1.57: d1dw3b_
  • Chain 'C':
    Domains in SCOP 1.57: d1dw3c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dw3A (A:)
    gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
    keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dw3B (B:)
    gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
    keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dw3C (C:)
    gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
    keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq