PDB entry 1dw3
View 1dw3 on RCSB PDB site
Description: structure of a reduced oxygen binding cytochrome c
Class: oxygen storage/transport
Keywords: cytochrome c, reduced, disulfide bridge, asparagine ligation, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on
2000-01-24, released
2000-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated
2021-03-03, with a file datestamp of
2021-02-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.36
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: cytochrome c
Species: Rhodobacter sphaeroides [TaxId:1063]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1dw3a_ - Chain 'B':
Compound: cytochrome c
Species: Rhodobacter sphaeroides [TaxId:1063]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1dw3b_ - Chain 'C':
Compound: cytochrome c
Species: Rhodobacter sphaeroides [TaxId:1063]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1dw3c_ - Heterogens: HEC, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1dw3A (A:)
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1dw3B (B:)
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1dw3C (C:)
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq