PDB entry 1dw1

View 1dw1 on RCSB PDB site
Description: structure of the cyanide complex of shp, an oxygen binding cytochrome c
Deposited on 2000-01-24, released 2000-06-28
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-27, with a file datestamp of 2000-12-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dw1a_
  • Chain 'B':
    Domains in SCOP 1.55: d1dw1b_
  • Chain 'C':
    Domains in SCOP 1.55: d1dw1c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dw1A (A:)
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dw1B (B:)
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dw1C (C:)
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq