PDB entry 1dw0

View 1dw0 on RCSB PDB site
Description: structure of oxidized shp, an oxygen binding cytochrome c
Class: oxygen storage/transport
Keywords: cytochrome c, asparagine ligation, oxygen binding, disulfide bridge, OXYGEN STORAGE-TRANSPORT COMPLEX
Deposited on 2000-01-24, released 2000-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dw0a_
  • Chain 'B':
    Compound: cytochrome c
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dw0b_
  • Chain 'C':
    Compound: cytochrome c
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dw0c_
  • Heterogens: SO4, HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dw0A (A:)
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dw0B (B:)
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dw0C (C:)
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq