PDB entry 1dvx

View 1dvx on RCSB PDB site
Description: crystal structure of human transthyretin in complex with diclofenac
Class: hormone/growth factor
Keywords: thyroxine transport, signaling protein, hormone-growth factor complex
Deposited on 2000-01-23, released 2001-01-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dvxa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dvxb_
  • Heterogens: DIF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dvxA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvxA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dvxB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeqfvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dvxB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt