PDB entry 1dvx

View 1dvx on RCSB PDB site
Description: crystal structure of human transthyretin in complex with diclofenac
Deposited on 2000-01-23, released 2001-01-23
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-23, with a file datestamp of 2001-01-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dvxa_
  • Chain 'B':
    Domains in SCOP 1.55: d1dvxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dvxA (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dvxB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeqfvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvt