PDB entry 1dvr

View 1dvr on RCSB PDB site
Description: structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP
Class: transferase (phosphotransferase)
Keywords: nucleoside monophosphate kinase, myokinase, transferase (phosphotransferase)
Deposited on 1995-12-14, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.191
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07170 (0-218)
      • engineered (88)
      • engineered (164)
    Domains in SCOPe 2.07: d1dvra1, d1dvra2
  • Chain 'B':
    Compound: adenylate kinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07170 (0-218)
      • engineered (88)
      • engineered (164)
    Domains in SCOPe 2.07: d1dvrb1, d1dvrb2
  • Heterogens: ATF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dvrA (A:)
    ssesirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqg
    glvsddimvnmikdeltnnpackngfilvgfprtipqaekldqmlkeqgtplekaielkv
    ddellvaritgrlihpasgrsyhkifnppkedmkddvtgealvqisddnadalkkrlaay
    haqtepivdfykktgiwagvdasqppatvwadilnklgkn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dvrB (B:)
    ssesirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqg
    glvsddimvnmikdeltnnpackngfilvgfprtipqaekldqmlkeqgtplekaielkv
    ddellvaritgrlihpasgrsyhkifnppkedmkddvtgealvqisddnadalkkrlaay
    haqtepivdfykktgiwagvdasqppatvwadilnklgkn